CD13 (ANPEP) Rabbit Polyclonal Antibody

CAT#: TA343101

Rabbit Polyclonal Anti-ANPEP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 106 kDa
Gene Name alanyl aminopeptidase, membrane
Background Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma.
Synonyms APN; CD13; GP150; LAP1; P150; PEPN
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 85%; Guinea pig: 85%; Dog: 79%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane
Protein Pathways Glutathione metabolism, Hematopoietic cell lineage, Metabolic pathways, Renin-angiotensin system
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...