1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	1-acylglycerol-3-phosphate O-acyltransferase 4
Database Link	NP_064518 Entrez Gene 56895 Human UniProt ID Q9NRZ5
Background	This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.
Synonyms	1-AGPAT4; dJ473J16.2; LPAAT-delta
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Horse: 92%; Zebrafish: 90%; Dog: 85%; Rat: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.