CAB39L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CAB39L antibody: synthetic peptide directed towards the N terminal of human CAB39L. Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	calcium binding protein 39 like
Database Link	NP_112187 Entrez Gene 81617 Human UniProt ID Q9H9S4
Background	The function of this protein remains unknown.
Synonyms	bA103J18.3; MO2L; MO25-BETA
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Pathways	mTOR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.