RGH19 (ARHGAP19) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARHGAP19 antibody: synthetic peptide directed towards the C terminal of human ARHGAP19. Synthetic peptide located within the following region: PTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	Rho GTPase activating protein 19
Database Link	NP_116289 Entrez Gene 84986 Human UniProt ID Q14CB8
Background	Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases, which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression.
Synonyms	DKFZp313K217; MGC14258; MGC138804; MGC138805
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Bovine: 91%; Rat: 83%; Mouse
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.