HSH2D Rabbit Polyclonal Antibody
CAT#: TA343027
Rabbit Polyclonal Anti-HSH2D Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HSH2D antibody: synthetic peptide directed towards the C terminal of human HSH2D. Synthetic peptide located within the following region: DPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | hematopoietic SH2 domain containing |
Database Link | |
Background | T-cell activation requires 2 signals: recognition of antigen by the T-cell receptor and a costimulatory signal provided primarily by CD28 in naive T cells. HSH2 is a target of both of these signaling pathways. |
Synonyms | ALX; HSH2 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 82% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |