SFT2C (SFT2D3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SFT2D3 antibody: synthetic peptide directed towards the N terminal of human SFT2D3. Synthetic peptide located within the following region: EYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	SFT2 domain containing 3
Database Link	NP_116129 Entrez Gene 84826 Human UniProt ID Q587I9
Background	SFT2D3 may be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex .
Synonyms	MGC5391
Note	Immunogen Sequence Homology: Human: 100%; Yeast
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.