TBRG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TBRG1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBRG1. Synthetic peptide located within the following region: DVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	transforming growth factor beta regulator 1
Database Link	NP_116200 Entrez Gene 84897 Human UniProt ID Q3YBR2
Background	TBRG1 acts as a growth inhibitor. It can activate p53/TP53, causes G1 arrest and collaborates with CDKN2A to restrict proliferation, but does not require either protein to inhibit DNA synthesis. TBRG1 redistributes CDKN2A into the nucleoplasm and is involved in maintaining chromosomal stability.
Synonyms	NIAM; TB-5
Note	Immunogen Sequence Homology: Human: 100%; Pig: 85%; Horse: 85%; Rabbit: 85%; Rat
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.