SESN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SESN2 antibody: synthetic peptide directed towards the N terminal of human SESN2. Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	sestrin 2
Database Link	NP_113647 Entrez Gene 83667 Human UniProt ID P58004
Background	This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions.
Synonyms	HI95; SES2; SEST2
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 88%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Pathways	p53 signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.