TBC1D10A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TBC1D10A antibody: synthetic peptide directed towards the C terminal of human TBC1D10A. Synthetic peptide located within the following region: GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	TBC1 domain family member 10A
Database Link	NP_114143 Entrez Gene 83874 Human UniProt ID Q9BXI6
Background	The function of this protein remains unknown.
Synonyms	dJ130H16.1; dJ130H16.2; EPI64; TBC1D10
Note	Immunogen Sequence Homology: Human: 100%; Pig: 83%; Guinea pig: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.