FCAMR Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FCAMR antibody: synthetic peptide directed towards the C terminal of human FCAMR. Synthetic peptide located within the following region: ATLSQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	Fc fragment of IgA and IgM receptor
Database Link	NP_001164102 Entrez Gene 83953 Human UniProt ID Q8WWV6
Background	The function of this protein remains unknown.
Synonyms	CD351; FCA; FKSG87; MR
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.