ANKRD32 (SLF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANKRD32 antibody: synthetic peptide directed towards the N terminal of human ANKRD32. Synthetic peptide located within the following region: TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	SMC5-SMC6 complex localization factor 1
Database Link	NP_115666 Entrez Gene 84250 Human UniProt ID Q9BQI6
Background	The function remains unknown.
Synonyms	ANKRD32; BRCTD1; BRCTx
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Rat: 82%; Pig: 75%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.