ACBD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACBD6 antibody: synthetic peptide directed towards the middle region of human ACBD6. Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	acyl-CoA binding domain containing 6
Database Link	NP_115736 Entrez Gene 84320 Human UniProt ID Q9BR61
Background	ACBD6 binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. Does not bind fatty acids.
Synonyms	MGC2404
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.