SPIRE2 Rabbit Polyclonal Antibody
CAT#: TA342930
Rabbit Polyclonal Anti-SPIRE2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | spire type actin nucleation factor 2 |
Database Link | |
Background | SPIRE2 acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. It is involved in vesicle transport processes providing a novel link between actin organization and intracellular transport . |
Synonyms | Spir-2 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Zebrafish: 93%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Pathways | Dorso-ventral axis formation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |