IL1F10 Rabbit Polyclonal Antibody
CAT#: TA342892
Rabbit Polyclonal Anti-IL1F10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IL1F10 antibody: synthetic peptide directed towards the middle region of human IL1F10. Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 17 kDa |
Gene Name | interleukin 1 family member 10 (theta) |
Database Link | |
Background | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. |
Synonyms | FIL1-theta; FKSG75; IL-1HY2; IL-38; IL1-theta; IL1HY2 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |