IL1F10 Rabbit Polyclonal Antibody

CAT#: TA342892

Rabbit Polyclonal Anti-IL1F10 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-IL1F10 antibody: synthetic peptide directed towards the middle region of human IL1F10. Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 17 kDa
Gene Name interleukin 1 family member 10 (theta)
Background The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses.
Synonyms FIL1-theta; FKSG75; IL-1HY2; IL-38; IL1-theta; IL1HY2
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...