MRGPRF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MRGPRF antibody: synthetic peptide directed towards the C terminal of human MRGPRF. Synthetic peptide located within the following region: PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	MAS related GPR family member F
Database Link	NP_659452 Entrez Gene 116535 Human UniProt ID Q96AM1
Background	MRGPRF is an orphan receptor. It may bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Synonyms	GPR140; GPR168; MRGF; RTA
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.