DNAJC19 Rabbit Polyclonal Antibody

CAT#: TA342749

Rabbit Polyclonal Anti-DNAJC19 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DNAJC19 antibody: synthetic peptide directed towards the C terminal of human DNAJC19. Synthetic peptide located within the following region: LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 13 kDa
Gene Name DnaJ heat shock protein family (Hsp40) member C19
Background The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Several transcript variants, some protein-coding and some not, have been found for this gene.
Synonyms PAM18; TIM14; TIMM14
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...