ALDH1A2 Rabbit Polyclonal Antibody

CAT#: TA342735

Rabbit Polyclonal Anti-ALDH1A2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name aldehyde dehydrogenase 1 family member A2
Background Aldh1a2 recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. It does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently.
Synonyms RALDH(II); RALDH2; RALDH2-T
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%; Sheep: 83%; Yeast
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Retinol metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...