PLEKHG2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLEKHG2 antibody: synthetic peptide directed towards the middle region of human PLEKHG2. Synthetic peptide located within the following region: DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	144 kDa
Gene Name	pleckstrin homology and RhoGEF domain containing G2
Database Link	NP_073746 Entrez Gene 64857 Human UniProt ID Q9H7P9
Background	PLEKHG2 may be a transforming oncogene with exchange activity for CDC42. PLEKHG2 may be a guanine-nucleotide exchange factor (GEF) for RAC1 and CDC42.PLEKHG2 activated by the binding to subunits beta and gamma of the heterotrimeric guanine nucleotide-binding protein (G protein).
Synonyms	ARHGEF42; CLG; LDAMD
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.