SNAP29 Rabbit Polyclonal Antibody
CAT#: TA342641
Rabbit Polyclonal Anti-SNAP29 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 29 kDa |
| Gene Name | synaptosome associated protein 29kDa |
| Database Link | |
| Background | This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. |
| Synonyms | CEDNIK; SNAP-29 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Mouse: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
