MYRIP Rabbit Polyclonal Antibody
CAT#: TA342617
Rabbit Polyclonal Anti-MYRIP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MYRIP antibody is: synthetic peptide directed towards the C-terminal region of Human MYRIP. Synthetic peptide located within the following region: QQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | myosin VIIA and Rab interacting protein |
Database Link | |
Background | MYRIP is a rab effector protein involved in melanosome transport. It serves as link between melanosome-bound RAB27A and the motor proteins MYO5A and MYO7A. It may link RAB27A-containing vesicles to actin filaments, functions as a protein kinase A-anchoring protein (AKAP) and may act as a scaffolding protein that links PKA to components of the exocytosis machinery, thus facilitating exocytosis, including insulin release. |
Synonyms | SLAC2-C; SLAC2C |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |