MYRIP Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYRIP antibody is: synthetic peptide directed towards the C-terminal region of Human MYRIP. Synthetic peptide located within the following region: QQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKERKGTTKD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	myosin VIIA and Rab interacting protein
Database Link	NP_056275 Entrez Gene 25924 Human UniProt ID Q8NFW9
Background	MYRIP is a rab effector protein involved in melanosome transport. It serves as link between melanosome-bound RAB27A and the motor proteins MYO5A and MYO7A. It may link RAB27A-containing vesicles to actin filaments, functions as a protein kinase A-anchoring protein (AKAP) and may act as a scaffolding protein that links PKA to components of the exocytosis machinery, thus facilitating exocytosis, including insulin release.
Synonyms	SLAC2-C; SLAC2C
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Dog: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.