CENPU Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the N-terminal region of Human MLF1IP. Synthetic peptide located within the following region: IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	centromere protein U
Database Link	NP_078905 Entrez Gene 79682 Human UniProt ID Q71F23
Background	The function of this protein remains unknown.
Synonyms	CENP50; CENPU50; KLIP1; MLF1IP; PBIP1
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 79%; Horse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.