AIMP2 Rabbit Polyclonal Antibody
CAT#: TA342583
Rabbit Polyclonal Anti-AIMP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the middle region of human AIMP2. Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | aminoacyl tRNA synthetase complex interacting multifunctional protein 2 |
Database Link | |
Background | The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. |
Synonyms | JTV-1; JTV1; P38; PRO0992 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |