PLAC1L (OOSP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLAC1L antibody: synthetic peptide directed towards the middle region of human PLAC1L. Synthetic peptide located within the following region: YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	oocyte secreted protein 2
Database Link	NP_776162 Entrez Gene 219990 Human UniProt ID Q86WS3
Background	The function remains unknown.
Synonyms	PLAC1L; TMEM122
Note	Immunogen Sequence Homology: Human: 100%; Horse: 83%; Rat: 80%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.