PLEKHO1 Rabbit Polyclonal Antibody

CAT#: TA342531

Rabbit Polyclonal Anti-PLEKHO1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of pleckstrin homology domain containing, family O member 1 (PLEKHO1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human pleckstrin homology domain containing, family O member 1 (PLEKHO1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human pleckstrin homology domain containing, family O member 1 (PLEKHO1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PLEKHO1 antibody: synthetic peptide directed towards the N terminal of human PLEKHO1. Synthetic peptide located within the following region: MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name pleckstrin homology domain containing O1
Background PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
Synonyms CKIP-1; CKIP1; JBP; OC120
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 86%; Rat: 82%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...