IRX6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IRX6 antibody: synthetic peptide directed towards the N terminal of human IRX6. Synthetic peptide located within the following region: SFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	iroquois homeobox 6
Database Link	NP_077311 Entrez Gene 79190 Human UniProt ID P78412
Background	IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates.
Synonyms	IRX-3; IRX7; IRXB3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.