TAF13 Rabbit Polyclonal Antibody
CAT#: TA342436
Rabbit Polyclonal Anti-TAF13 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13. Synthetic peptide located within the following region: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 14 kDa |
Gene Name | TATA-box binding protein associated factor 13 |
Database Link | |
Background | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq, Jul 2008] |
Synonyms | TAF(II)18; TAF2K; TAFII-18; TAFII18 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |