ETV3L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ETV3L antibody: synthetic peptide directed towards the C terminal of human ETV3L. Synthetic peptide located within the following region: LPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERLW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	ETS variant 3 like
Database Link	NP_001004341 Entrez Gene 440695 Human UniProt ID Q6ZN32
Background	Transcriptional regulator.
Synonyms	FLJ16478
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 92%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.