STYK1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Styk1 antibody is: synthetic peptide directed towards the middle region of Mouse Styk1. Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	serine/threonine/tyrosine kinase 1
Database Link	NP_060893 Entrez Gene 243659 Mouse UniProt ID Q6J9G0
Background	The function of this protein remains unknown.
Synonyms	NOK; SuRTK106
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome, Protein Kinase, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.