LRRN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRN3 antibody: synthetic peptide directed towards the N terminal of human LRRN3. Synthetic peptide located within the following region: ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	leucine rich repeat neuronal 3
Database Link	NP_001093130 Entrez Gene 54674 Human UniProt ID Q9H3W5
Background	LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
Synonyms	FIGLER5; NLRR-3; NLRR3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.