RUNX3 Rabbit Polyclonal Antibody
CAT#: TA342336
Rabbit Polyclonal Anti-RUNX3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3. Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | runt related transcription factor 3 |
Database Link | |
Background | RUNX3 belongs to The RUNX family of transcription factors that are important regulators of linage-specific gene expression in major developmental pathways. Runx3 is highly expressed in developing cranial and dorsal root ganglia (DRGs). |
Synonyms | AML2; CBFA3; PEBP2aC |
Note | Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Inflammation-driven colon neoplasmatogenesis in uPA-deficient mice is associated with an increased expression of Runx transcriptional regulators.
,null,
Experimental cell research
,PubMed ID 29107070
[RUNX3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |