Pdlim1 Rabbit Polyclonal Antibody
CAT#: TA342321
Rabbit Polyclonal Anti-PDLIM1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PDLIM1 antibody: synthetic peptide directed towards the middle region of mouse PDLIM1. Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 36 kDa |
| Gene Name | PDZ and LIM domain 1 (elfin) |
| Database Link | |
| Background | Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton. |
| Synonyms | CLIM1; CLP-36; CLP36; elfin; enigma; hCLIM1 |
| Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
