UNCX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Uncx antibody is synthetic peptide directed towards the N-terminal region of Rat Uncx. Synthetic peptide located within the following region: VVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	UNC homeobox
Database Link	NP_001073930 Entrez Gene 29375 Rat UniProt ID A6NJT0
Background	novel paired homeodomain transcription factor that may be a possible downstream target of MASH1 [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: D87748.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369736, SRS369739 [ECO:0000348] ##Evidence-Data-END##
Synonyms	UNCX4.1
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Human: 93%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.