NFAT1 (NFATC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the N terminal of mouse NFATC2. Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	102 kDa
Gene Name	nuclear factor of activated T-cells 2
Database Link	NP_036472 Entrez Gene 18019 Mouse UniProt ID Q13469
Background	Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway.
Synonyms	NFAT1; NFATP
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 86%; Dog: 82%; Pig: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Axon guidance, B cell receptor signaling pathway, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.