Msx3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Msx3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Msx3. Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	msh homeobox 3
Database Link	NP_034966 Entrez Gene 114504 Rat UniProt ID P70354
Background	mouse homolog represses transcription of Msx1; repression may be mediated by binding to cAMP-response element binding protein CBP and histone deacetylase 1 [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS369732 [ECO:0000348] ##Evidence-Data-END##
Synonyms	AI323377
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.