MRE11 Rabbit Polyclonal Antibody
CAT#: TA342247
Rabbit polyclonal Anti-MRE11A Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5200.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Concentration | lot specific | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 80 kDa | 
| Gene Name | MRE11 homolog A, double strand break repair nuclease | 
| Database Link | |
| Background | This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe DNA fragments.This gene has a pseudogene on chromosome 3. Alternative splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] | 
| Synonyms | ATLD; HNGS1; MRE11; MRE11B | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93% | 
| Reference Data | |
| Protein Families | Druggable Genome, Stem cell - Pluripotency | 
| Protein Pathways | Homologous recombination, Non-homologous end-joining | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
