PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody

CAT#: TA342234

Rabbit polyclonal Anti-PIP4K2A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (PIP4K2A)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (PIP4K2A), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (PIP4K2A), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
Background Phosphatidylinositol-5,4-bisphosphate,The precursor to second messengers ofThe phosphoinositide signal transduction pathways, is thought to be involved inThe regulation of secretion, cell proliferation, differentiation, and motility.The protein encoded byThis gene is one of a family of enzymes capable of catalyzingThe phosphorylation of phosphatidylinositol-5-phosphate onThe fourth hydroxyl ofThe myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate.The amino acid sequence ofThis enzyme does not show homology to other kinases, butThe recombinant protein does exhibit kinase activity.This gene is a member ofThe phosphatidylinositol-5-phosphate 4-kinase family. [provided by RefSeq, Jul 2008]
Synonyms PI5P4KA; PIP5K2A; PIP5KII-alpha; PIP5KIIA; PIPK
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...