OMD Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OMD antibody: synthetic peptide directed towards the middle region of human OMD. Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	osteomodulin
Database Link	NP_005005 Entrez Gene 4958 Human UniProt ID Q99983
Background	OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts viaThe alpha(V)beta(3)-integrin.
Synonyms	OSAD; SLRR2C
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Rabbit: 92%; Dog: 86%; Bovine: 86%; Horse: 85%; Zebrafish: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.