NDUFS1 Rabbit Polyclonal Antibody
CAT#: TA342230
Rabbit polyclonal Anti-NDUFS1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human, Mouse, Rat |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-NDUFS1 antibody: synthetic peptide directed towards the middle region of human NDUFS1. Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 77 kDa |
| Gene Name | NADH:ubiquinone oxidoreductase core subunit S1 |
| Database Link | |
| Background | The protein encoded byThis gene belongs toThe complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates atThe mitochondrial inner membrane.This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone.This protein isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where NADH is oxidized. Mutations inThis gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2011] |
| Synonyms | CI-75k; CI-75Kd; PRO1304 |
| Note | Immunogen Sequence Homology: Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79% |
| Reference Data | |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
