NDUFS1 Rabbit Polyclonal Antibody

CAT#: TA342229

Rabbit polyclonal Anti-Ndufs1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase) (NDUFS1), nuclear gene encoding mitochondrial protein
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase) (NDUFS1), nuclear gene encoding mitochondrial protein, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase) (NDUFS1), nuclear gene encoding mitochondrial protein, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Ndufs1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ndufs1. Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 79 kDa
Gene Name NADH:ubiquinone oxidoreductase core subunit S1
Background Core subunit ofThe mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong toThe minimal assembly required for catalysis. Complex I functions inThe transfer of electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone (By similarity).This isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where NADH is oxidized.
Synonyms CI-75k; CI-75Kd; PRO1304
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Goat: 86%; Zebrafish: 86%; Yeast: 85%
Reference Data
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...