RAB27A Rabbit Polyclonal Antibody
CAT#: TA342222
Rabbit polyclonal Anti-RAB27A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | RAB27A, member RAS oncogene family |
Database Link | |
Background | The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Alternative splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008] |
Synonyms | GS2; HsT18676; RAB27; RAM |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Goat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |