SH3BP2 Rabbit Polyclonal Antibody
CAT#: TA342205
Rabbit polyclonal Anti-SH3BP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | SH3 domain binding protein 2 |
Database Link | |
Background | The protein encoded byThis gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain.The protein binds toThe SH3 domains of several proteins includingThe ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations inThis gene result in cherubism. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009] |
Synonyms | 3BP-2; 3BP2; CRBM; CRPM; RES4-23 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |