SET Rabbit Polyclonal Antibody

CAT#: TA342203

Rabbit polyclonal Anti-SET Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of SET nuclear oncogene (SET), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human SET nuclear oncogene (SET), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human SET nuclear oncogene (SET), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, IP, WB
Recommend Dilution WB, IHC, IP
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 32 kDa
Gene Name SET nuclear proto-oncogene
Background The protein encoded byThis gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT).This inhibition is most likely accomplished by masking histone lysines from being acetylated, andThe consequence is to silence HAT-dependent transcription.The encoded protein is part of a complex localized toThe endoplasmic reticulum but is found inThe nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes.This protein can also enhance DNA replication ofThe adenovirus genome. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Oct 2011]
Synonyms 2PP2A; I2PP2A; IGAAD; IPP2A2; PHAPII; TAF-I; TAF-IBETA
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Phosphatase, Stem cell - Pluripotency
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...