SET Rabbit Polyclonal Antibody
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, IP, WB |
Recommend Dilution | WB, IHC, IP |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | SET nuclear proto-oncogene |
Database Link | |
Background | The protein encoded byThis gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT).This inhibition is most likely accomplished by masking histone lysines from being acetylated, andThe consequence is to silence HAT-dependent transcription.The encoded protein is part of a complex localized toThe endoplasmic reticulum but is found inThe nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes.This protein can also enhance DNA replication ofThe adenovirus genome. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Oct 2011] |
Synonyms | 2PP2A; I2PP2A; IGAAD; IPP2A2; PHAPII; TAF-I; TAF-IBETA |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |