S4 (PSMC1) Rabbit Polyclonal Antibody
CAT#: TA342172
Rabbit polyclonal Anti-Psmc1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Psmc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | proteasome 26S subunit, ATPase 1 |
Database Link | |
Background | The 26S protease is involved inThe ATP-dependent degradation of ubiquitinated proteins.The regulatory (or ATPase) complex confers ATP dependency and substrate specificity toThe 26S complex. |
Synonyms | P26S4; p56; S4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Proteasome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |