ZNF121 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF121 antibody: synthetic peptide directed towards the middle region of human ZNF121. Synthetic peptide located within the following region: LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	zinc finger protein 121
Database Link	NP_001008727 Entrez Gene 7675 Human UniProt ID P58317
Background	ZNF121 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers. ZNF121 may be involved in transcriptional regulation.
Synonyms	D19S204; ZHC32; ZNF20
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Rat: 83%; Horse: 83%; Mouse: 83%; Bovine: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.