TCEAL4 Rabbit Polyclonal Antibody

CAT#: TA342116

Rabbit Polyclonal Anti-TCEAL4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human transcription elongation factor A (SII)-like 4 (TCEAL4), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of transcription elongation factor A (SII)-like 4 (TCEAL4), transcript variant 1
    • 100 ug

CNY 3080.00


Transient overexpression lysate of transcription elongation factor A (SII)-like 4 (TCEAL4), transcript variant 4
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TCEAL4 antibody: synthetic peptide directed towards the middle region of human TCEAL4. Synthetic peptide located within the following region: GSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name transcription elongation factor A like 4
Background TCEAL4 is a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome.This gene encodes a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome. Alternative splicing occurs forThis gene; however,The full-length nature of all transcript variants has not yet been described.
Synonyms NPD017; WEX7
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Rat: 90%; Dog: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...