IRAG1 Rabbit Polyclonal Antibody
CAT#: TA342098
Rabbit Polyclonal Anti-MRVI1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MRVI1 antibody is: synthetic peptide directed towards the N-terminal region of Human MRVI1. Synthetic peptide located within the following region: LVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 88 kDa |
Gene Name | murine retrovirus integration site 1 homolog |
Database Link | |
Background | This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV).The encoded protein, which is found inThe membrane ofThe endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation.This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by alteringThe expression of a gene important for myeloid cell growth and/or differentiation, and thusThis gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found forThis gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used. |
Synonyms | IRAG; JAW1L |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Vascular smooth muscle contraction |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
miR-940 potentially promotes proliferation and metastasis of endometrial carcinoma through regulation of MRVI1
,Zhou, Z;Xu, YP;Wang, LJ;Kong, Y;,
Biosci. Rep.
,PubMed ID 31085718
[IRAG1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |