ASB5 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ASB5 antibody: synthetic peptide directed towards the C terminal of human ASB5. Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | ankyrin repeat and SOCS box containing 5 |
Database Link | |
Background | ASB5 is a member ofThe¡¡ankyrin repeat and SOCS box-containing (ASB) family of proteins.¡¡They contain ankyrin repeat sequence and SOCS box domain.The SOCS¡¡box serves to couple suppressor of cytokine signalling (SOCS)¡¡proteins andTheir binding partners withThe elongin B and C¡¡complex, possibly targetingThem for degradation.The protein encoded byThis gene is a member ofThe ankyrin repeat and SOCS box-containing (ASB) family of proteins.They contain ankyrin repeat sequence and SOCS box domain.The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins andTheir binding partners withThe elongin B and C complex, possibly targetingThem for degradation. Multiple alternatively spliced transcript variants have been described forThis gene butTheir full length sequences are not known. |
Synonyms | ASB-5 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |