ANKH Rabbit Polyclonal Antibody

CAT#: TA342080

Rabbit Polyclonal Anti-ANKH Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of ankylosis, progressive homolog (mouse) (ANKH)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ANKH antibody: synthetic peptide directed towards the N terminal of human ANKH. Synthetic peptide located within the following region: SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 54 kDa
Gene Name ANKH inorganic pyrophosphate transport regulator
Background ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.This gene encodes a multipass transmembrane protein that is expressed in joints and other tissues and controls pyrophosphate levels in cultured cells. Progressive ankylosis-mediated control of pyrophosphate levels has been suggested as a possible mechanism regulating tissue calcification and susceptibility to arthritis in higher animals. Mutations inThis gene have been associated with autosomal dominant craniometaphyseal dysplasia. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
Synonyms ANK; CCAL2; CMDJ; CPPDD; HANK; MANK
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...