SIGLECL1 (SIGLEC12) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SIGLEC12 antibody: synthetic peptide directed towards the N terminal of human SIGLEC12. Synthetic peptide located within the following region: DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	sialic acid binding Ig like lectin 12 (gene/pseudogene)
Database Link	NP_443729 Entrez Gene 89858 Human UniProt ID Q96PQ1
Background	Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging toThe immunoglobulin superfamily.They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member ofThe SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruitThe Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested thatThe protein is involved inThe negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions ofThis protein target confirmThe same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging toThe immunoglobulin superfamily.They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins.This gene encodes a member ofThe SIGLEC3-like subfamily of SIGLECs. Members ofThis subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, andThe cytoplasmic tyrosine-based motifs ITIM and SLAM-like.The encoded protein, upon tyrosine phosphorylation, has been shown to recruitThe Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested thatThe protein is involved inThe negative regulation of macrophage signaling by functioning as an inhibitory receptor.This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described forThis gene.
Synonyms	S2V; Siglec-XII; SIGLECL1; SLG
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.