RFT1 Rabbit Polyclonal Antibody

CAT#: TA342065

Rabbit Polyclonal Anti-RFT1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 60 kDa
Gene Name RFT1 homolog
Background N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a¡¡Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation.N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation (Helenius et al., 2002 [PubMed 11807558]). [supplied by OMIM]
Synonyms CDG1N
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%
Reference Data
Protein Families Transmembrane
Protein Pathways N-Glycan biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...